Structure of PDB 8bq6 Chain BI Binding Site BS01

Receptor Information
>8bq6 Chain BI (length=57) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FEGFYKLIMRRNSVYVTFIIAGAFFGERAVDYGVHKLWERNNVGKRYEDI
SVLGQRP
Ligand information
>8bq6 Chain BJ (length=28) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IDIQAAAGWGIAAAAGAIWVVQPFGWIK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bq6 Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		S25 T29 I32 F36
Binding residue
(residue number reindexed from 1)		S13 T17 I20 F24
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005829 cytosol
GO:0045275 respiratory chain complex III

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bq6, PDBe:8bq6, PDBj:8bq6
PDBsum8bq6
PubMed36585502
UniProtQ9LXJ2|QCR9_ARATH Cytochrome b-c1 complex subunit 9, mitochondrial (Gene Name=QCR9)

[Back to BioLiP]