Structure of PDB 4v6i Chain BH Binding Site BS01

Receptor Information
>4v6i Chain BH (length=197) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQKKILSIRLKVPPTIAQFQYTLDRNTAAETFKLFNKYRPETAAEKKERL
TKEAAAVAEGKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIANDVDP
IELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAEDEA
ALAKLVSTIDANFADKYDEVKKHWGGGILGNKAQAKMDKRAKNSDSA
Ligand information
>4v6i Chain Bq (length=25) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MRAKWRKKRTRRLKRKRRKVRARSK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v6i Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
Resolution8.8 Å
Binding residue
(original residue number in PDB)		S121 Q123 D124 K193
Binding residue
(residue number reindexed from 1)		S62 Q64 D65 K134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000470 maturation of LSU-rRNA
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6i, PDBe:4v6i, PDBj:4v6i
PDBsum4v6i
PubMed20980660
UniProtP17076|RL8A_YEAST Large ribosomal subunit protein eL8A (Gene Name=RPL8A)

[Back to BioLiP]