Structure of PDB 4v7h Chain BG Binding Site BS01

Receptor Information
>4v7h Chain BG (length=113) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERLTKEAAAVAEGKSKQDASPKPYAVKYGLNHVVALIENKKAKLVLIAND
VDPIELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVRAE
DEAALAKLVSTID
Ligand information
>4v7h Chain B4 (length=157) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaauguagguugcagaauuccgugaaucaucgaucuu
ugaacgcacauugcgccccuugguauuccagggggcaugccuguuugagc
gucauuu
.........................................<<<<<<...
.....>>>.......<<<......................>>>.....>>
>...............<<<<<<<....>>>>>>>................
.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
Resolution8.9 Å
Binding residue
(original residue number in PDB)
E107 K120 Q123 N155 D156 V157 D158 K181 G182 R185
Binding residue
(residue number reindexed from 1)
E1 K14 Q17 N49 D50 V51 D52 K75 G76 R79
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Mon Feb 17 08:05:16 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v7h', asym_id = 'BG', bs = 'BS01', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v7h', asym_id='BG', bs='BS01', title='Comprehensive molecular structure of the eukaryotic ribosome.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0042254,1990904', uniprot = '', pdbid = '4v7h', asym_id = 'BG'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042254,1990904', uniprot='', pdbid='4v7h', asym_id='BG')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>