Structure of PDB 8wo5 Chain BF Binding Site BS01

Receptor Information
>8wo5 Chain BF (length=133) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQV
DAAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGE
MVNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ
Ligand information
>8wo5 Chain BG (length=13) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GGVPGALSNQPAP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wo5 Cryo-EM structure of the intact flagellar motor-hook complex in the CCW state
Resolution7.4 Å
Binding residue
(original residue number in PDB)		L3 L4 N5 I6 D8 P55 G56 T59 M125
Binding residue
(residue number reindexed from 1)		L2 L3 N4 I5 D7 P54 G55 T58 M124
External links
PDB RCSB:8wo5, PDBe:8wo5, PDBj:8wo5
PDBsum8wo5
PubMed
UniProtP0A1I7|FLGC_SALTY Flagellar basal-body rod protein FlgC (Gene Name=flgC)

[Back to BioLiP]