Structure of PDB 4v7h Chain BE Binding Site BS01

Receptor Information
>4v7h Chain BE (length=237) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVVRFTNKDI
ICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGLLIARRTL
QRLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRTTTGARVF
GALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGHVSQYMEE
LADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAI
Ligand information
>4v7h Chain B3 (length=113) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
guuaagcuguagagccgacaguaguguagggugaccauacgcgaaacuca
ggugcugcaaucu
<<<<<<<<<....<<<..........<<..<.............>...>>
..........>>>.<.........<<<<.<<...>>.>>>>.........
>..>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
Resolution8.9 Å
Binding residue
(original residue number in PDB)		A11 T18 P19 F20 R21 R22 R24 K27 T28 Y30 R33 T46 P47 K48 Y49 K58 T70 V73 Y79 W95 R112 R152 T154 R158 T187 E189 I190 D214 D215 E216 E217 F223 K224 G225 Y226 L227 A228
Binding residue
(residue number reindexed from 1)		A1 T8 P9 F10 R11 R12 R14 K17 T18 Y20 R23 T36 P37 K38 Y39 K48 T60 V63 Y69 W85 R102 R142 T144 R148 T177 E179 I180 D204 D205 E206 E207 F213 K214 G215 Y216 L217 A218
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 23 04:34:30 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '4v7h', asym_id = 'BE', bs = 'BS01', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='4v7h', asym_id='BE', bs='BS01', title='Comprehensive molecular structure of the eukaryotic ribosome.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '4v7h', asym_id = 'BE'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='4v7h', asym_id='BE')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>