Structure of PDB 4v5e Chain BC Binding Site BS01

Receptor Information
>4v5e Chain BC (length=190) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVYTIDEAARTAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVR
VLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFVMGAVGSKLGRIL
GPRGLNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPE
KLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTTMGPSVR
Ligand information
>4v5e Chain AW (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.......
<<.........>>..>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v5e Insights Into Translational Termination from the Structure of Rf2 Bound to the Ribosome.
Resolution3.45 Å
Binding residue
(original residue number in PDB)
D50 R52 R53
Binding residue
(residue number reindexed from 1)
D27 R29 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v5e, PDBe:4v5e, PDBj:4v5e
PDBsum4v5e
PubMed18988853
UniProtQ5SLP7|RL1_THET8 Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]