Structure of PDB 8s1r Chain BBB Binding Site BS01

Receptor Information
>8s1r Chain BBB (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSDYIIKEKTVLLQKKDSEGFGFVLRGAKEFTPTPAFPALQYLESVD
EGGVAWRAGLRMGDFLIEVNGQNVVKVGHRQVVNMIRQGGNTLMVKVVMV
TRHP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8s1r Biophysical and structural analyses of the interaction between the SHANK1 PDZ domain and an internal SLiM.
Resolution1.979 Å
Binding residue
(original residue number in PDB)		D670 E672 G673 G675 F676 V677 L678 R679 G680 K682 Y701 E703 D706 H735 R736 V739
Binding residue
(residue number reindexed from 1)		D20 E22 G23 G25 F26 V27 L28 R29 G30 K32 Y45 E47 D50 H79 R80 V83
External links
PDB RCSB:8s1r, PDBe:8s1r, PDBj:8s1r
PDBsum8s1r
PubMed38899489
UniProtQ9Y566|SHAN1_HUMAN SH3 and multiple ankyrin repeat domains protein 1 (Gene Name=SHANK1)

[Back to BioLiP]