Structure of PDB 7oiq Chain BBB Binding Site BS01

Receptor Information
>7oiq Chain BBB (length=250) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HQIGWRREGIKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYL
SGMPECKFGMNDKISIAIDDCTFHQCVRLSERSISFIPPDGEFELMRYRT
TKDIILPFRVIPLVREVGRTKLEVKVVIKSNFKPSLLAQKIEVRIPTPLN
TSGVQVICMKGKAKYKASENAIVWKIKRMAGMKESQISAEIELLPWARPP
ISMNFEVPFAPSGLKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7oiq FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P 2 -dependent switch.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		F174 K420 W421 V422 R423
Binding residue
(residue number reindexed from 1)		F18 K235 W236 V237 R238
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oiq, PDBe:7oiq, PDBj:7oiq
PDBsum7oiq
PubMed35486718
UniProtP84092|AP2M1_RAT AP-2 complex subunit mu (Gene Name=Ap2m1)

[Back to BioLiP]