Structure of PDB 7o00 Chain BBB Binding Site BS01

Receptor Information
>7o00 Chain BBB (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTV
YPAKTNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQT
LVMLETVPEVYTCQVEHPSLTSPLTVEWRA
Ligand information
>7o00 Chain CCC (length=14) Species: 1773 (Mycobacterium tuberculosis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RKPFQSVIADTGIS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7o00 Key interactions in the trimolecular complex consisting of the rheumatoid arthritis-associated DRB1*04:01 molecule, the major glycosylated collagen II peptide and the T-cell receptor.
Resolution2.24 Å
Binding residue
(original residue number in PDB)		H13 Y30 Y47 D57 Y60 W61 L67 Y78 H81 N82 V85
Binding residue
(residue number reindexed from 1)		H12 Y29 Y46 D56 Y59 W60 L66 Y77 H80 N81 V84
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7o00, PDBe:7o00, PDBj:7o00
PDBsum7o00
PubMed35027402
UniProtA0A1V1IGJ9

[Back to BioLiP]