Structure of PDB 7nzh Chain BBB Binding Site BS01

Receptor Information

>7nzh Chain BBB (length=189) Species: 9606 (Homo sapiens)

DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTV
YPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNG
DWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA

Ligand information

>7nzh Chain EEE (length=14) Species: 9606 (Homo sapiens)

GKLYGItDVtSTRD

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7nzh Key interactions in the trimolecular complex consisting of the rheumatoid arthritis-associated DRB1*04:01 molecule, the major glycosylated collagen II peptide and the T-cell receptor.
• Resolution: 2.831 Å
• Binding residue (original residue number in PDB): H13 F26 Y30 D57 Y60 W61 K71 Y78 H81 N82 V85
• Binding residue (residue number reindexed from 1): H12 F25 Y29 D56 Y59 W60 K70 Y77 H80 N81 V84

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Mon Nov 25 08:47:48 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7nzh', asym_id = 'BBB', bs = 'BS01', title = 'Key interactions in the trimolecular complex con...ted collagen II peptide and the T-cell receptor. '

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7nzh', asym_id='BBB', bs='BS01', title='Key interactions in the trimolecular complex con...ted collagen II peptide and the T-cell receptor. ')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0006955,0016020,0019882,0042613', uniprot = '', pdbid = '7nzh', asym_id = 'BBB'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006955,0016020,0019882,0042613', uniprot='', pdbid='7nzh', asym_id='BBB')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>