Structure of PDB 7nw1 Chain BBB Binding Site BS01

Receptor Information
>7nw1 Chain BBB (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADND
WFRLESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPEL
DGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPD
LIQKGVIQHKEKC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nw1 Structural basis for UFM1 transfer from UBA5 to UFC1.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		K33 Y36 I40 V43 K47 R55
Binding residue
(residue number reindexed from 1)		K31 Y34 I38 V41 K45 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0061657 UFM1 conjugating enzyme activity
GO:0071568 UFM1 transferase activity
Biological Process
GO:0007420 brain development
GO:0032649 regulation of type II interferon production
GO:0034976 response to endoplasmic reticulum stress
GO:0061709 reticulophagy
GO:0071569 protein ufmylation
GO:1990592 protein K69-linked ufmylation
Cellular Component
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nw1, PDBe:7nw1, PDBj:7nw1
PDBsum7nw1
PubMed34588452
UniProtQ9Y3C8|UFC1_HUMAN Ubiquitin-fold modifier-conjugating enzyme 1 (Gene Name=UFC1)

[Back to BioLiP]