Structure of PDB 7bbp Chain BBB Binding Site BS01

Receptor Information
>7bbp Chain BBB (length=120) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSYDIQAWKKQCEELLNLIFQCEDSEPFRQPVDLLEYPDYRDIIDTPMDF
ATVRETLEAGNYESPMELCKDVRLIFSNSKAYTPSKRSRIYSMSLRLSAF
FEEHISSVLSDYKSALRFHK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7bbp Crystal Structure of the second bromodomain of Pleckstrin homology domain interacting protein (PHIP) in complex with H4K5acK8ac
Resolution1.99 Å
Binding residue
(original residue number in PDB)
V1345 I1356 A1394 T1396 P1397 S1398 S1401 I1403
Binding residue
(residue number reindexed from 1)
V32 I43 A81 T83 P84 S85 S88 I90
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7bbp, PDBe:7bbp, PDBj:7bbp
PDBsum7bbp
PubMed
UniProtQ8WWQ0|PHIP_HUMAN PH-interacting protein (Gene Name=PHIP)

[Back to BioLiP]