Structure of PDB 6sqq Chain BBB Binding Site BS01

Receptor Information
>6sqq Chain BBB (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQ
AWVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sqq Expanding crystallization tools for nucleic acid complexes using U1A protein variants.
Resolution2.37 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 L44 S48 L49 K50 M51 R52 Q54 W56 K80 Q85 A87 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y9 N11 N12 E15 K18 L40 S44 L45 K46 M47 R48 Q50 W52 K76 Q81 A83 K84 D86 S87 D88
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6sqq, PDBe:6sqq, PDBj:6sqq
PDBsum6sqq
PubMed32070773
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]