Structure of PDB 6qzd Chain BBB Binding Site BS01

Receptor Information
>6qzd Chain BBB (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRA
VTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKV
TVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQ
NGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA
Ligand information
>6qzd Chain CCC (length=14) Species: 11320 (Influenza A virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGPLKAEIAQRLED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qzd CD4+T Cells Recognize Conserved Influenza A Epitopes through Shared Patterns of V-Gene Usage and Complementary Biochemical Features.
Resolution2.66 Å
Binding residue
(original residue number in PDB)
F13 D57 Y60 W61 L67 Q70 R71 T77 Y78 H81 N82 V85 S88
Binding residue
(residue number reindexed from 1)
F14 D58 Y61 W62 L68 Q71 R72 T78 Y79 H82 N83 V86 S89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6qzd, PDBe:6qzd, PDBj:6qzd
PDBsum6qzd
PubMed32668259
UniProtP01911|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]