Structure of PDB 8wl2 Chain BB Binding Site BS01

Receptor Information
>8wl2 Chain BB (length=132) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQVD
AAPGQATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEM
VNTMSASRSYQANIEVLNTVKSMMLKTLTLGQ
Ligand information
>8wl2 Chain BJ (length=16) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PGGVPGALSNQPAPPN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wl2 Cryo-EM structure of the membrane-anchored part of the flagellar motor-hook complex in the CW state.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Q46 V47 F49 N104
Binding residue
(residue number reindexed from 1)		Q44 V45 F47 N102
External links
PDB RCSB:8wl2, PDBe:8wl2, PDBj:8wl2
PDBsum8wl2
PubMed
UniProtP0A1I7|FLGC_SALTY Flagellar basal-body rod protein FlgC (Gene Name=flgC)

[Back to BioLiP]