Structure of PDB 7qfh Chain BA Binding Site BS01

Receptor Information

>7qfh Chain BA (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LPKSVDWRKKGYVTPVKNQKQCGSAWAFSATGALEGQMFRKTGKLVSLSE
QNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKY
RPENSVAQDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSG
IYFEPDCSSKNLDHGVLVVGYGFEGANSQNSKYWLVKNSWGPEWGSNGYV
KIAKDKNNHCGIATAASYPNV

Ligand information

>7qfh Chain PB (length=3) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KVL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7qfh Proteomic data and structure analysis combined reveal interplay of structural rigidity and flexibility on selectivity of cysteine cathepsins.
Resolution	1.52 Å
Binding residue (original residue number in PDB)	G248 A250 N291 G292 G293 F294 D388 H389 G390
Binding residue (residue number reindexed from 1)	G23 A25 N66 G67 G68 F69 D163 H164 G165

Enzymatic activity

Enzyme Commision number

3.4.22.43: cathepsin V.

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7qfh, PDBe:7qfh, PDBj:7qfh
PDBsum	7qfh
PubMed	37095140
UniProt	O60911\|CATL2_HUMAN Cathepsin L2 (Gene Name=CTSV)

[Back to BioLiP]