Structure of PDB 6ztj Chain B7 Binding Site BS01

Receptor Information

>6ztj Chain B7 (length=70) Species: 562 (Escherichia coli)

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRD
VATGGRVDRFNKRFNIPGSK

Ligand information

>6ztj Chain BB (length=120)

ugccuggcggccguagcgcgguggucccaccugaccccaugccgaacuca
gaagugaaacgccguagcgccgaugguaguguggggucuccccaugcgag
aguagggaacugccaggcau

<<<<<<<<<<.....<<<<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>>.>>.<<.......<<<<<<<<...>>>>>>>>...
....>>...>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6ztj Structural basis of transcription-translation coupling and collision in bacteria.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): M1 K2
• Binding residue (residue number reindexed from 1): M1 K2

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006413 translational initiation
• GO:1904689 negative regulation of cytoplasmic translational initiation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ztj, PDBe:6ztj, PDBj:6ztj
• PDBsum: 6ztj
• PubMed: 32820062
• UniProt: P0A7M9|RL31_ECOLI Large ribosomal subunit protein bL31 (Gene Name=rpmE)