Structure of PDB 8qzs Chain B6 Binding Site BS01

Receptor Information

>8qzs Chain B6 (length=90) Species: 9606 (Homo sapiens)

RLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAY
VVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKM

Ligand information

>8qzs Chain 2 (length=98)

cgcuucucggccaaguguaguaucuguucuuaucaguuuaauaucugaua
gauuuuuggagcaucgaccugguauugcaguaccuccaggaacggugc

...............................<<<<<.<....>.>>>>>.
..........<<<<<<.<<<<<.............>>>>>..>>>>>>

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8qzs Structural insights into the cross-exon to cross-intron spliceosome switch
• Resolution: 4.1 Å
• Binding residue (original residue number in PDB): E16 Y22 Y91 Y92 N93 R96
• Binding residue (residue number reindexed from 1): E5 Y11 Y80 Y81 N82 R85

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0001825 blastocyst formation
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0005684 U2-type spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0005689 U12-type spliceosomal complex
• GO:0071011 precatalytic spliceosome
• GO:0071013 catalytic step 2 spliceosome

External links

• PDB: RCSB:8qzs, PDBe:8qzs, PDBj:8qzs
• PDBsum: 8qzs
• PubMed: 38778104
• UniProt: Q9Y3B4|SF3B6_HUMAN Splicing factor 3B subunit 6 (Gene Name=SF3B6)