Structure of PDB 7nsi Chain B6 Binding Site BS01

Receptor Information
>7nsi Chain B6 (length=52) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKTILVKMMSQAGTGFSFNTKRSRLREKLTLLHYDPVVKKKVLFVEQKKI
RS
Ligand information
>7nsi Chain AV (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu
uuuuuuuuuuuuuuuuuucca
..................................................
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nsi Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
Resolution4.6 Å
Binding residue
(original residue number in PDB)		L37 S64
Binding residue
(residue number reindexed from 1)		L25 S52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005739 mitochondrion
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nsi, PDBe:7nsi, PDBj:7nsi
PDBsum7nsi
PubMed33878294
UniProtA0A4X1TLP9

[Back to BioLiP]