Structure of PDB 4v69 Chain B5 Binding Site BS01

Receptor Information
>4v69 Chain B5 (length=234) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGI
DARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDL
ADQIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVA
EAVKNAKAGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAK
PTQAKGVYIKKVSISTTMGAGVAVDQAGLSASVN
Ligand information
>4v69 Chain AW (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>>.<<<<<<.....>>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v69 Ribosome-induced changes in elongation factor Tu conformation control GTP hydrolysis
Resolution6.7 Å
Binding residue
(original residue number in PDB)		R53 K54 S55 L127 G128 Q129 V130 K141
Binding residue
(residue number reindexed from 1)		R53 K54 S55 L127 G128 Q129 V130 K141
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0045947 negative regulation of translational initiation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v69, PDBe:4v69, PDBj:4v69
PDBsum4v69
PubMed19122150
UniProtP0A7L0|RL1_ECOLI Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]