Structure of PDB 4v4x Chain B3 Binding Site BS01

Receptor Information
>4v4x Chain B3 (length=71) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKEGIHPKLVPARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFV
DTEGRVERFQRRYGDSYRKGR
Ligand information
>4v4x Chain AD (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccgagguagcucaguugguagagcaugcgacugaaaaucgcagugucgg
cgguucgauuccgcuccucggcacca
<<<<<<<..<<<<........>>>>.<<<<<.......>>>>>.....<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4v4x Structural basis for messenger RNA movement on the ribosome.
Resolution5.0 Å
Binding residue
(original residue number in PDB)
I22 T27 E30
Binding residue
(residue number reindexed from 1)
I22 T27 E30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v4x, PDBe:4v4x, PDBj:4v4x
PDBsum4v4x
PubMed17051149
UniProtQ5SJE1|RL31_THET8 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]