Structure of PDB 8oiq Chain B1 Binding Site BS01

Receptor Information
>8oiq Chain B1 (length=45) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEISDLNELLKKTL
Ligand information
>8oiq Chain B2 (length=27) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQQLVQDIASLTLLEISDLNELLKKTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oiq Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		Y24 I28 L50
Binding residue
(residue number reindexed from 1)		Y15 I19 L41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oiq, PDBe:8oiq, PDBj:8oiq
PDBsum8oiq
PubMed37141370
UniProtA0A8D0VGD9

[Back to BioLiP]