Structure of PDB 1vy7 Chain B1 Binding Site BS01

Receptor Information

>1vy7 Chain B1 (length=97) Species: 300852 (Thermus thermophilus HB8)

SKVCEISGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRV
RVAGQEITFRVAASHIPKVYELVERAKGLKLEGLSPKEIKKELLKLL

Ligand information

>1vy7 Chain AY (length=5)

cacca

.....

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1vy7 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.
• Resolution: 2.8 Å
• Binding residue (original residue number in PDB): K23 V30
• Binding residue (residue number reindexed from 1): K22 V29

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1vy7, PDBe:1vy7, PDBj:1vy7
• PDBsum: 1vy7
• PubMed: 25132179
• UniProt: P60494|RL28_THET8 Large ribosomal subunit protein bL28 (Gene Name=rpmB)