Structure of PDB 9ins Chain B Binding Site BS01

Receptor Information

>9ins Chain B (length=30) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>9ins Chain A (length=21) Species: 9823 (Sus scrofa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCTSICSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	9ins Monovalent cation binding to cubic insulin crystals
Resolution	1.7 Å
Binding residue (original residue number in PDB)	V2 N3 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25
Binding residue (residue number reindexed from 1)	V2 N3 Q4 H5 L6 C7 L15 C19 R22 G23 F24 F25

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:9ins, PDBe:9ins, PDBj:9ins
PDBsum	9ins
PubMed	1504238
UniProt	P01315\|INS_PIG Insulin (Gene Name=INS)

[Back to BioLiP]