Structure of PDB 9cyl Chain B Binding Site BS01

Receptor Information
>9cyl Chain B (length=188) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTEL
GRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVIS
LSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGD
WTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9cyl Structural basis for mouse LAG3 interactions with the MHC class II molecule I-A b.
Resolution4.66 Å
Binding residue
(original residue number in PDB)
F38 Y57 H74 W88 R97 E101 T104 V105 H108 N109 P112
Binding residue
(residue number reindexed from 1)
F8 Y27 H44 W58 R67 E71 T74 V75 H78 N79 P83
External links
PDB RCSB:9cyl, PDBe:9cyl, PDBj:9cyl
PDBsum9cyl
PubMed39209860
UniProtP14483|HB2A_MOUSE H-2 class II histocompatibility antigen, A beta chain (Gene Name=H2-Ab1)

[Back to BioLiP]