Structure of PDB 9bdv Chain B Binding Site BS01

Receptor Information

>9bdv Chain B (length=274) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYT
GPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLG
IQCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRD
PAGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCD
KVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVR
VSMQLRRPSDRELSEPMEFQYLPD

Ligand information

>9bdv Chain C (length=18) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actgggaatttccagtga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	9bdv Transient interactions modulate affinity of NF-kappaB transcription factors for DNA
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y36 C38 K122 K123 R187 Q220 K221 Q247
Binding residue (residue number reindexed from 1)	Y19 C21 K105 K106 R170 Q203 K204 Q230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:9bdv, PDBe:9bdv, PDBj:9bdv
PDBsum	9bdv
PubMed	38805268
UniProt	Q04207\|TF65_MOUSE Transcription factor p65 (Gene Name=Rela)

[Back to BioLiP]