Structure of PDB 9b8u Chain B Binding Site BS01

Receptor Information
>9b8u Chain B (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFK
NRRAKCRQQRQQQKQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b8u Molecular basis of CRX homeodomain/DNA binding and stoichiometry at the Ret4 cis-regulatory element in rhodopsin promoter
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R41 R43 T44 F46 R82 N89
Binding residue
(residue number reindexed from 1)		R3 R5 T6 F8 R44 N51
External links
PDB RCSB:9b8u, PDBe:9b8u, PDBj:9b8u
PDBsum9b8u
PubMed39084215
UniProtO43186|CRX_HUMAN Cone-rod homeobox protein (Gene Name=CRX)

[Back to BioLiP]