Structure of PDB 9b3p Chain B Binding Site BS01

Receptor Information
>9b3p Chain B (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTE
HAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>9b3p Chain I (length=128) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgtatatatctgacacgtgcctggagactagggagtaatccccttggcgg
ttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctg
tctacgaccaattgagcggcctcggcac
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9b3p Structural and Biochemical Characterization of the Nucleosome Containing Variants H3.3 and H2A.Z
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R45 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R21 I22 S23 G24 R54 K55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:9b3p, PDBe:9b3p, PDBj:9b3p
PDBsum9b3p
PubMed38920622
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]