Structure of PDB 9azj Chain B Binding Site BS01

Receptor Information
>9azj Chain B (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEDLKQQLQQAEEALVAKQEVIDKLCEEAEQHKIVMETVPVLKAQADIYK
ADFQAERQAREKLAEKKELLQEQLEQLQREYSK
Ligand information
>9azj Chain G (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RWACQSCTFENEAAAVLCSICERPRLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9azj Structure of TAB2 NZF domain bound to K6 / Lys6-linked diubiquitin
Resolution3.32 Å
Binding residue
(original residue number in PDB)		L274 Q278 D282
Binding residue
(residue number reindexed from 1)		L15 Q19 D23
External links
PDB RCSB:9azj, PDBe:9azj, PDBj:9azj
PDBsum9azj
PubMed
UniProtQ9Y6K9|NEMO_HUMAN NF-kappa-B essential modulator (Gene Name=IKBKG)

[Back to BioLiP]