Structure of PDB 9ant Chain B Binding Site BS01

Receptor Information
>9ant Chain B (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRM
KWKKEN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9ant Comparison of X-ray and NMR structures for the Antennapedia homeodomain-DNA complex.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R5 Y25 R31 R53 M54 K57
Binding residue
(residue number reindexed from 1)		R1 Y21 R27 R49 M50 K53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:9ant, PDBe:9ant, PDBj:9ant
PDBsum9ant
PubMed9699632
UniProtP02833|ANTP_DROME Homeotic protein antennapedia (Gene Name=Antp)

[Back to BioLiP]