Structure of PDB 8zyc Chain B Binding Site BS01

Receptor Information
>8zyc Chain B (length=101) Species: 362663 (Escherichia coli 536) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTVDKLNQKQESAIKKIDNTIKNALKDHDIIGTLKDMDGKPVPKENGGYW
DAMQEMQNTLRGLRNHADTLKNVNNPEAQAAYGRATDAINKIESALKGYG
I
Ligand information
>8zyc Chain C (length=73) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggcuuguagcucaggugguuagagcgcaccccugauaagggugaggucg
gugguucaaguccacucaggccu
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>>.....<
<<<<.......>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zyc Mechanism of activation of contact-dependent growth inhibition tRNase toxin by the amino acid biogenesis factor CysK in the bacterial competition system.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		N133 Q134 S138 K142 N145 T146 N149 E171 W176 Q180 E181 R187 H192
Binding residue
(residue number reindexed from 1)		N7 Q8 S12 K16 N19 T20 N23 E45 W50 Q54 E55 R61 H66
External links
PDB RCSB:8zyc, PDBe:8zyc, PDBj:8zyc
PDBsum8zyc
PubMed
UniProtQ0T963|CDIA_ECOL5 tRNA nuclease CdiA (Gene Name=cdiA)

[Back to BioLiP]