Structure of PDB 8zlz Chain B Binding Site BS01

Receptor Information
>8zlz Chain B (length=130) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKWRSQLDRFVKENQQDLAALFWGLWLENGDSQGTIGIDLQPTPHFVYCP
KDAVEKLNNNVENRLQELLGIIEHNQPEIEVLMIGIGKGEIKLIQFAPEP
PPPVCFEQVGKDIDGLLELLEQRMSGEIVV
Ligand information
>8zlz Chain D (length=15) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
FRENVNAIRPFGRRP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8zlz Molecular interactions of the chaperone CcmS and carboxysome shell protein CcmK1 that mediate beta-carboxysome assembly.
Resolution1.67 Å
Binding residue
(original residue number in PDB)		D51 Q53 V59 Y60 A65 L69 D126 E130
Binding residue
(residue number reindexed from 1)		D39 Q41 V47 Y48 A53 L57 D114 E118
External links