Structure of PDB 8z9c Chain B Binding Site BS01

Receptor Information
>8z9c Chain B (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8z9c Chain M (length=48) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguu
................................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z9c Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution3.01 Å
Binding residue
(original residue number in PDB)		T20 G21 K28 K52 G53 R56 S57 F90 G91 S92 M93 G94 A96 T118 H119 L120 R121 I122 K127 F133 G174
Binding residue
(residue number reindexed from 1)		T19 G20 K27 K51 G52 R55 S56 F89 G90 S91 M92 G93 A95 T117 H118 L119 R120 I121 K126 F132 G173
External links