Structure of PDB 8z4j Chain B Binding Site BS01

Receptor Information
>8z4j Chain B (length=157) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTMKKIYVTMKTLSPLYTGEPVRKTATNKVLIPFKGALRSALEIMLKAKG
NVCDTGESRARPCGRCVTCSLFGSMGRAGRASVDFLISNDTKEGEEVIET
FTATITISNPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDV
ATDRFLK
Ligand information
>8z4j Chain M (length=38) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugc
......................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4j Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		E22 P50 K52 G53 A54 R56 T73 P80 S92 M93 A96
Binding residue
(residue number reindexed from 1)		E20 P33 K35 G36 A37 R39 T55 P62 S74 M75 A78
External links