Structure of PDB 8z4b Chain B Binding Site BS01

Receptor Information
>8z4b Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGEKGFFYTDKT
Ligand information
>8z4b Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8z4b Crystal structure of LysB22-AspB28 insulin analog at ambient structure
Resolution2.5 Å
Binding residue
(original residue number in PDB)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 K22 G23 F24 F25
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 V18 C19 K22 G23 F24 F25
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8z4b, PDBe:8z4b, PDBj:8z4b
PDBsum8z4b
PubMed
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]