Structure of PDB 8yzs Chain B Binding Site BS01

Receptor Information
>8yzs Chain B (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NQIGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVL
LRRLLASFFDRNTLANSCGTGIRSSTNDPRRKPLDSRVLHAVKYYCQNFA
PNFKESEMNAIAADMCTNARRVVRKSWMP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yzs Structural basis of DNA recognition by BEN domain proteins reveals a role for oligomerization in unmethylated DNA selection by BANP.
Resolution2.31 Å
Binding residue
(original residue number in PDB)		R400 D462 N466 R469 R472
Binding residue
(residue number reindexed from 1)		R52 D114 N118 R121 R124
External links
PDB RCSB:8yzs, PDBe:8yzs, PDBj:8yzs
PDBsum8yzs
PubMed39225042
UniProtQ96RE7|NACC1_HUMAN Nucleus accumbens-associated protein 1 (Gene Name=NACC1)

[Back to BioLiP]