Structure of PDB 8yhd Chain B Binding Site BS01

Receptor Information
>8yhd Chain B (length=199) Species: 256318 (metagenome) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTMKKIYVTMKTLSPLYTGEVRREDKEAAQKRVNFPVRKTATNKVLIPF
KGALRSALEIMLKAKGENVCDTGESRARPCGRCVTCSLFGSMGRAGRASV
DFLISNDTKEQIVRESTHLRIERQTKSASDTFKGEEVIEGATFTATITIS
NPQEKDLSLIQSALKFIEENGIGGWLNKGYGRVSFEVKSEDVATDRFLK
Ligand information
>8yhd Chain M (length=53) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaaaacucuucucaugcuggauucgaaauuaggugcgcuucgcguuua
agu
..................................................
...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yhd Structural basis for the activity of the type VII CRISPR-Cas system.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		G21 E22 F37 R40 P50 K52 G53 A54 S57 G91 S92 M93 A96 T118 H119 L120 R121 I122 R124 K127 A129 F133 W176 N178
Binding residue
(residue number reindexed from 1)		G20 E21 F36 R39 P49 K51 G52 A53 S56 G90 S91 M92 A95 T117 H118 L119 R120 I121 R123 K126 A128 F132 W175 N177
External links