Structure of PDB 8yh9 Chain B Binding Site BS01

Receptor Information
>8yh9 Chain B (length=175) Species: 2053611 (Selenomonas sp.) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MFSQILIIKPGTGISPNIIISEDIFPVLHSLFVEHDKKFGITFPAYSFDK
KGHLGNIIEVLSEDKEALASLCLEEHLAEVTDYVKVKKEITFTDDYVLFK
RIREENQYETTARRMRKRGHTELGRPLEMHIKKKNQQIFCHAYIKVKSAS
TGQSYNIFLAPTDIKHGSFSAYGLL
Ligand information
>8yh9 Chain C (length=60) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuagaaggagaagucauuuaauaaggccacuguuaaaaaguguaccgcc
ggauaggcgg
.............................................<<<<<
.....>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yh9 Mechanisms for HNH-mediated target DNA cleavage in type I CRISPR-Cas systems
Resolution3.35 Å
Binding residue
(original residue number in PDB)		S15 N17 I18 K37 E105 T110 R114 M115 R118 L127 E128 I131 F139 Y143 K145 A149 S150 S154 Y155 N156 A171
Binding residue
(residue number reindexed from 1)		S15 N17 I18 K37 E105 T110 R114 M115 R118 L127 E128 I131 F139 Y143 K145 A149 S150 S154 Y155 N156 A171
External links