Structure of PDB 8w2o Chain B Binding Site BS01

Receptor Information
>8w2o Chain B (length=178) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYRNKARDIINKHNHK
RRHIGKRGRKERENSSQNETLKVTCLSNKEKRHIMHVKKMNQKELAQTSI
DTLKLLYDGSPGYSKVFVDANRFDIGDLVKRAQTSRSRDETCESNPFPRL
NNPKKLEPPKILSQWSNTIPKTSIFYSV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8w2o Selected humanization of yeast U1 snRNP leads to global suppression of pre-mRNA splicing and mitochondrial dysfunction in the budding yeast.
Resolution3.49 Å
Binding residue
(original residue number in PDB)		T11 H24 G27
Binding residue
(residue number reindexed from 1)		T9 H22 G25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
GO:0030619 U1 snRNA binding
GO:0030627 pre-mRNA 5'-splice site binding
GO:0046872 metal ion binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000395 mRNA 5'-splice site recognition
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0000243 commitment complex
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005685 U1 snRNP
GO:0071004 U2-type prespliceosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8w2o, PDBe:8w2o, PDBj:8w2o
PDBsum8w2o
PubMed38688558
UniProtQ05900|RU1C_YEAST U1 small nuclear ribonucleoprotein C (Gene Name=YHC1)

[Back to BioLiP]