Structure of PDB 8vnt Chain B Binding Site BS01

Receptor Information

>8vnt Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV

Ligand information

>8vnt Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgactctcttaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8vnt Homing endonuclease I-PpoI-DNA complex:reaction with 500 uM Mg2+ for 160s
Resolution	1.62 Å
Binding residue (original residue number in PDB)	L316 N323
Binding residue (residue number reindexed from 1)	L115 N122

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8vnt, PDBe:8vnt, PDBj:8vnt
PDBsum	8vnt
PubMed
UniProt	Q94702\|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]