Structure of PDB 8vns Chain B Binding Site BS01

Receptor Information

>8vns Chain B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV

Ligand information

>8vns Chain c (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gagagtca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8vns Homing endonuclease I-PpoI-DNA complex:reaction with 500 uM Mg2+ for 160s
Resolution	2.11 Å
Binding residue (original residue number in PDB)	N257 R261 Q263 R274 T295 A296 N319
Binding residue (residue number reindexed from 1)	N56 R60 Q62 R73 T94 A95 N118

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8vns, PDBe:8vns, PDBj:8vns
PDBsum	8vns
PubMed
UniProt	Q94702\|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]