Structure of PDB 8vgd Chain B Binding Site BS01

Receptor Information
>8vgd Chain B (length=72) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVD
YETLMKVMDTLHQAGYLKIGLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vgd Discovery and structural characterization of the D-box, a conserved TonB motif that couples an inner-membrane motor to outer-membrane transport.
Resolution1.42 Å
Binding residue
(original residue number in PDB)
D120 I130 G131 L132
Binding residue
(residue number reindexed from 1)
D59 I69 G70 L71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0022857 transmembrane transporter activity
Biological Process
GO:0055085 transmembrane transport

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8vgd, PDBe:8vgd, PDBj:8vgd
PDBsum8vgd
PubMed38311172
UniProtP0ABV2|EXBD_ECOLI Biopolymer transport protein ExbD (Gene Name=exbD)

[Back to BioLiP]