Structure of PDB 8vcy Chain B Binding Site BS01

Receptor Information
>8vcy Chain B (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVT
ISPSNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQIL
VMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vcy A structural basis of T cell cross-reactivity to a native and spliced self-antigens presented by HLA-DQ8
Resolution2.6 Å
Binding residue
(original residue number in PDB)		F11 Y30 Y37 Y60 W61 V67 R70 E74 V78 N82 L85
Binding residue
(residue number reindexed from 1)		F11 Y30 Y37 Y60 W61 V67 R70 E74 V78 N82 L85
External links