Structure of PDB 8vcx Chain B Binding Site BS01

Receptor Information
>8vcx Chain B (length=191) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVT
PLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTI
SPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNG
DWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vcx A structural basis of T cell cross-reactivity to a native and spliced self-antigens presented by HLA-DQ8
Resolution2.59 Å
Binding residue
(original residue number in PDB)		F11 Y30 Y37 A57 Y60 W61 R70 E74 V78 L85
Binding residue
(residue number reindexed from 1)		F10 Y29 Y36 A56 Y59 W60 R69 E73 V77 L84
External links