Structure of PDB 8udk Chain B Binding Site BS01

Receptor Information
>8udk Chain B (length=369) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAE
WWTSVVVFREQVFPVDALHHKPGPLRENLLHGALEHYVNCLDLVNKRLPY
GLAQIGVCFHPVFGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWW
RKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLH
MYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTFTRKKN
LHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPG
YLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMM
HISKLKDFLIKYISSAKNV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8udk An interaction network in the polymerase active site is a prerequisite for Watson-Crick base pairing in Pol gamma.
Resolution3.43 Å
Binding residue
(original residue number in PDB)		R328 N330
Binding residue
(residue number reindexed from 1)		R215 N217
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003887 DNA-directed DNA polymerase activity
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
GO:0042802 identical protein binding
GO:0070182 DNA polymerase binding
Biological Process
GO:0001701 in utero embryonic development
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006264 mitochondrial DNA replication
GO:0007005 mitochondrion organization
GO:0032042 mitochondrial DNA metabolic process
GO:0071897 DNA biosynthetic process
GO:1900264 positive regulation of DNA-directed DNA polymerase activity
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005760 gamma DNA polymerase complex
GO:0042645 mitochondrial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8udk, PDBe:8udk, PDBj:8udk
PDBsum8udk
PubMed38787958
UniProtQ9UHN1|DPOG2_HUMAN DNA polymerase subunit gamma-2 (Gene Name=POLG2)

[Back to BioLiP]