Structure of PDB 8ucv Chain B Binding Site BS01

Receptor Information
>8ucv Chain B (length=186) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ISLEQIDGFAAKSFPLCMRQLHKSLRENHHLRHGGRMQYGLFLKGIGLTL
EQALQFWRLEFTKGKVDSEKFDKVYAYSIRHNYGKEGKRTDYTPYSCMKV
ILSNPPSQGDYHGCPFRHSDPELLKQKLQSFKVPSSGINQILELVKGMHY
QLACQKYFELTHSVDDCGFSLNHPNQYFAESQKLLT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ucv A mechanistic model of primer synthesis from catalytic structures of DNA polymerase alpha-primase.
Resolution3.81 Å
Binding residue
(original residue number in PDB)		M313 K349 Y353 H357 N358 G363 K364 T366 Y368 T369 Y371 S372 K375
Binding residue
(residue number reindexed from 1)		M37 K73 Y77 H81 N82 G87 K88 T90 Y92 T93 Y95 S96 K99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
Cellular Component
GO:0005658 alpha DNA polymerase:primase complex
GO:1990077 primosome complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ucv, PDBe:8ucv, PDBj:8ucv
PDBsum8ucv
PubMed38491139
UniProtA0A1L8G3G3

[Back to BioLiP]