Structure of PDB 8uc6 Chain B Binding Site BS01

Receptor Information
>8uc6 Chain B (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSL
ENIQEKITEYLERVQALHSAVPLKSKHQLDLERAHFLVTQAFDEDEKENV
EDAIELYTEAVDLCLKTSYETADKVLQNKLKQLARQALDRAEALSEPL
Ligand information
>8uc6 Chain E (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VLPELPSVPDIDFDDLSRRFEELKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uc6 Calpain-7:IST1 Complex
Resolution2.701 Å
Binding residue
(original residue number in PDB)		A10 V11 A14 D21 H22 Y33 K56 E59 Y60 R63 L87 E88 F98 Y113 Q142 A143
Binding residue
(residue number reindexed from 1)		A10 V11 A14 D21 H22 Y33 K56 E59 Y60 R63 L81 E82 F92 Y107 Q136 A137
Enzymatic activity
Enzyme Commision number 3.4.22.-
External links
PDB RCSB:8uc6, PDBe:8uc6, PDBj:8uc6
PDBsum8uc6
PubMed37772788
UniProtQ9Y6W3|CAN7_HUMAN Calpain-7 (Gene Name=CAPN7)

[Back to BioLiP]