Structure of PDB 8u8l Chain B Binding Site BS01

Receptor Information
>8u8l Chain B (length=123) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRIEKRTKFTVDDHVVAWKFIYEKLVEADKEGVQLMPKGIAFWNDFVRVT
RSSKSATNWSSHFRKIMCPGLHEMPLHKKTILYLLKNIGIEIDKETEQII
ERKFNVKLLVGIDRNLISYKLLD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u8l Caenorhabditis elegans telomere-binding proteins TEBP-1 and TEBP-2 adapt the Myb module to dimerize and bind telomeric DNA
Resolution2.2 Å
Binding residue
(original residue number in PDB)		I354 E355 K356 R357 K359 M387 K389 G390 I391 R415 K416
Binding residue
(residue number reindexed from 1)		I3 E4 K5 R6 K8 M36 K38 G39 I40 R64 K65
Enzymatic activity
Enzyme Commision number ?
External links