Structure of PDB 8u2y Chain B Binding Site BS01

Receptor Information
>8u2y Chain B (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFD
CVSCQPYVVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u2y MLL4 binds TET3.
ResolutionN/A
Binding residue
(original residue number in PDB)		E1516 E1517 D1518 L1519 L1520 Q1522 R1524 E1544 A1547 G1550
Binding residue
(residue number reindexed from 1)		E14 E15 D16 L17 L18 Q20 R22 E42 A45 G48
External links
PDB RCSB:8u2y, PDBe:8u2y, PDBj:8u2y
PDBsum8u2y
PubMed38579707
UniProtO14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D (Gene Name=KMT2D)

[Back to BioLiP]