Structure of PDB 8twa Chain B Binding Site BS01

Receptor Information
>8twa Chain B (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SINLHSAPEYDPSYKLIQLTPELLDIIQDPVQNHQLRFKSLDKDKSEVVL
CSHDKTWVLKQRKHSNTVLLMREFVPEQPITFDETLLFGLSKPYMDVVGF
AKTESEFETRETHGMDPKERFKVLFRLQSQWDLEDIKPLIEELNSRGMKI
DSFIMKYARRKRLGKKTVVTS
Ligand information
>8twa Chain C (length=26) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TVKIWVKYNEGFSNAVRKNVTWNNLW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8twa Cryo-EM reveals that Ctf18-RFC collaborates with PolE to load the PCNA clamp onto a leading strand DNA
Resolution4.1 Å
Binding residue
(original residue number in PDB)		K44 V49 L60 K61 Q62 R63 K64 S66 N67 F108 E109
Binding residue
(residue number reindexed from 1)		K43 V48 L59 K60 Q61 R62 K63 S65 N66 F107 E108
External links
PDB RCSB:8twa, PDBe:8twa, PDBj:8twa
PDBsum8twa
PubMed
UniProtP25559|DCC1_YEAST Sister chromatid cohesion protein DCC1 (Gene Name=DCC1)

[Back to BioLiP]